(data stored in ACNUC7421 zone)

EMBL: CP001053.PE142

CP001053.PE142       Location/Qualifiers
FT   CDS             complement(175511..175942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4133"
FT                   /product="PRC-barrel domain protein"
FT                   /note="PFAM: PRC-barrel domain protein; KEGG: bxe:Bxe_B0559
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4133"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18517"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEJ6"
FT                   /protein_id="ACD18517.1"
FT                   /translation="MKAKTLICATALAAICASQGAYAQIAGLQPLGGTVEQTNALLKGW
FT                   SVRRALVDEPVYNDLNDKIGSIYDVIISPDRKATYAVVSVGGFLGMGKHYVAIPVDHFE
FT                   IRDGNLFLAGATKDALKSVPEFEYNKLEKATKPRKVKAE"
     MKAKTLICAT ALAAICASQG AYAQIAGLQP LGGTVEQTNA LLKGWSVRRA LVDEPVYNDL        60
     NDKIGSIYDV IISPDRKATY AVVSVGGFLG MGKHYVAIPV DHFEIRDGNL FLAGATKDAL       120
     KSVPEFEYNK LEKATKPRKV KAE                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page