(data stored in ACNUC7421 zone)

EMBL: CP001053.PE148

CP001053.PE148       Location/Qualifiers
FT   CDS             complement(180638..180910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4140"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A2488 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4140"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18523"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEJ9"
FT                   /protein_id="ACD18523.1"
FT                   /translation="MKTKFVAALLLALSASAAAPAFASGYGPAPFYRPSVGAPASQRGQ
FT                   SAQTVAASNDDAGAAQAAYGGVVSGQSESASRVALAPRDNLYARH"
     MKTKFVAALL LALSASAAAP AFASGYGPAP FYRPSVGAPA SQRGQSAQTV AASNDDAGAA        60
     QAAYGGVVSG QSESASRVAL APRDNLYARH                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page