(data stored in ACNUC7421 zone)

EMBL: CP001053.PE150

CP001053.PE150       Location/Qualifiers
FT   CDS             181701..182837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4142"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0563 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4142"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18525"
FT                   /db_xref="GOA:B2TEK4"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEK4"
FT                   /protein_id="ACD18525.1"
FT                   /translation="MIPEDDRKIDADAQNRAASDGIRGEAAGEGGRGVIRSAATWLEQL
FT                   DPGTHRRIKGLRLVTAYGIAAALGTLQDVTHGLPGATLVGSLAGNFALWASVSEARVSR
FT                   PESSRDLAFLCAAAVLGAAMFIAFAPILQTLGAAGPELTLVTGAFLVGYLKRFGILGAG
FT                   MGSQIFIGQLLAYNIHLTPVDMPAVLVAGLIAMLASIVPRLLSGPAERPALTVLSPVDM
FT                   PDRWKLSAELIMGLQAASGALVVVVLNETIGLKESAWAITASTYVVAGSASGTAERVRR
FT                   RIIGTLVGVPLGLACLPLVEHVPLLAWAAVAAAMIIYAMALPERYDIACGAFAVTLIVT
FT                   LAIGGVHSISFLGARAWETLLGGVVGLLAAKFIFPLRV"
     MIPEDDRKID ADAQNRAASD GIRGEAAGEG GRGVIRSAAT WLEQLDPGTH RRIKGLRLVT        60
     AYGIAAALGT LQDVTHGLPG ATLVGSLAGN FALWASVSEA RVSRPESSRD LAFLCAAAVL       120
     GAAMFIAFAP ILQTLGAAGP ELTLVTGAFL VGYLKRFGIL GAGMGSQIFI GQLLAYNIHL       180
     TPVDMPAVLV AGLIAMLASI VPRLLSGPAE RPALTVLSPV DMPDRWKLSA ELIMGLQAAS       240
     GALVVVVLNE TIGLKESAWA ITASTYVVAG SASGTAERVR RRIIGTLVGV PLGLACLPLV       300
     EHVPLLAWAA VAAAMIIYAM ALPERYDIAC GAFAVTLIVT LAIGGVHSIS FLGARAWETL       360
     LGGVVGLLAA KFIFPLRV                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page