(data stored in ACNUC7421 zone)

EMBL: CP001053.PE151

CP001053.PE151       Location/Qualifiers
FT   CDS             complement(182877..183788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4143"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bam:Bamb_1614 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4143"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18526"
FT                   /db_xref="GOA:B2TEK5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEK5"
FT                   /protein_id="ACD18526.1"
FT                   /translation="MQRQFEDVLLGSIELFCLAAELESFTEAANAASVTPAAVSRTVAR
FT                   LEERLGVRLFVRTTRQIRLTDAGRRYFEQCRLALAQLAEAEREATGQQTAPTGVLRISM
FT                   PTPYGHYRVLPLLAEFRQRYPGVTVETHLSNRNIDFGEEGFDLAIRGAAPGDSGLIART
FT                   IEDAELVVVASPAYLRGAAKLKTPDDLVHHDCVQYALPSTGRNLPWLFKVEDEVVETMT
FT                   SGGYTSSGDVLAGATLARHGAGIFQTYRFIVEKDIAAGTLKELLIPYGGCSRPFVLLYP
FT                   HARHLSSRVRSFVDFLMEKLGS"
     MQRQFEDVLL GSIELFCLAA ELESFTEAAN AASVTPAAVS RTVARLEERL GVRLFVRTTR        60
     QIRLTDAGRR YFEQCRLALA QLAEAEREAT GQQTAPTGVL RISMPTPYGH YRVLPLLAEF       120
     RQRYPGVTVE THLSNRNIDF GEEGFDLAIR GAAPGDSGLI ARTIEDAELV VVASPAYLRG       180
     AAKLKTPDDL VHHDCVQYAL PSTGRNLPWL FKVEDEVVET MTSGGYTSSG DVLAGATLAR       240
     HGAGIFQTYR FIVEKDIAAG TLKELLIPYG GCSRPFVLLY PHARHLSSRV RSFVDFLMEK       300
     LGS                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page