(data stored in ACNUC7421 zone)

EMBL: CP001053.PE157

CP001053.PE157       Location/Qualifiers
FT   CDS             189796..192963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4149"
FT                   /product="transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /note="TIGRFAM: transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family; PFAM: acriflavin resistance protein; KEGG:
FT                   rme:Rmet_1702 hydrophobe/amphiphile efflux-1 HAE1"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4149"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18532"
FT                   /db_xref="GOA:B2TEL1"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEL1"
FT                   /protein_id="ACD18532.1"
FT                   /translation="MKFAHFFIDRPIFASVLSIILVVAGTVAMFNLPIAQFPDIAPPTI
FT                   TVSATYPGASAEVVAQNVAAPLEQQVNGADNMMYMNSSSSSTGNMTLTAYFNIGTDPSL
FT                   AQVDVQNRVNLALPTLPDSVTAQGVSVQKRSSAFMMVIAIYSPDNAFDQSYVANYANVY
FT                   VLDALKRIPGANQASIFGSADYAMRIWIKPDRMAKLSITVADVQQAISNQNQQFSAGRL
FT                   GQSPTNAPVQQTFPVATKGRMTKPADFDNIILRAGSGDASTIRIKDIGHAELGAKDYSL
FT                   RGRYNGKTATLIAVYQQPGANALQVAKQVHATLEQLQKAFPPGLKYEVALDTTEFVQES
FT                   IGEVIHTLRDAVILVILVVFIFLQSFRATLVPLLAVPVSILGAFIGMLVFGFSVNMLTL
FT                   FGMVLAIGIVVDDAIVVIENVERNMTEFGLPPKEAAKHAMDEVTGPVIAIVLVLLAVFI
FT                   PVAFLSGITGQLYKQFAVTIAVSVVISGIVALTLSPALAAILLKPGTHKKNRFFLWFNK
FT                   RFDRLTQGYGRAVQLAIRRVALSILLIVAMVAATAGLFKHIPSSFLPTEDQGYLLGAVV
FT                   LPDAASLDRTGNLSQRAEQWFAKQPAVKSVAAPIGYSLIDSQYKSNAGTLFITLKGFKD
FT                   RGENGTAQDLIRDANKAFSGYTDGVVVPLNPPSIPGLGTTGGFEFWLQSTGDGSYQNLE
FT                   EKVRAFIAKARQNPALRGVNSTINTNSRQLLVEVDRERAESLGVPIQDIYAALQTMFGS
FT                   SYVSQFPKSSRLFQVIVQAEPQYRTQPDDIQQLYVRNRSGDMVPIKAVTTVRFVPGADI
FT                   VTRFNNFPAAKITGDAAPGHSSGESIAAMEQIAHEVLGEGYSYAWSGQAYEEKQAGSTA
FT                   ILVFGFALLMVFLILAAQYEKWSLPIGVLLAVPFAIFGALIGILLRGMEDDVYFQIGLT
FT                   VLIALAAKNAILIFEFAVEMREKEALSPYDAALKAAKLRLRPIIMTSLAFILGCVPLAI
FT                   ASGASAASRRSLGTGVIFGMLGATVIALFFIPMFFWGLETLSSRGKKAPAPDAGPPVSP
FT                   GPREGGT"
     MKFAHFFIDR PIFASVLSII LVVAGTVAMF NLPIAQFPDI APPTITVSAT YPGASAEVVA        60
     QNVAAPLEQQ VNGADNMMYM NSSSSSTGNM TLTAYFNIGT DPSLAQVDVQ NRVNLALPTL       120
     PDSVTAQGVS VQKRSSAFMM VIAIYSPDNA FDQSYVANYA NVYVLDALKR IPGANQASIF       180
     GSADYAMRIW IKPDRMAKLS ITVADVQQAI SNQNQQFSAG RLGQSPTNAP VQQTFPVATK       240
     GRMTKPADFD NIILRAGSGD ASTIRIKDIG HAELGAKDYS LRGRYNGKTA TLIAVYQQPG       300
     ANALQVAKQV HATLEQLQKA FPPGLKYEVA LDTTEFVQES IGEVIHTLRD AVILVILVVF       360
     IFLQSFRATL VPLLAVPVSI LGAFIGMLVF GFSVNMLTLF GMVLAIGIVV DDAIVVIENV       420
     ERNMTEFGLP PKEAAKHAMD EVTGPVIAIV LVLLAVFIPV AFLSGITGQL YKQFAVTIAV       480
     SVVISGIVAL TLSPALAAIL LKPGTHKKNR FFLWFNKRFD RLTQGYGRAV QLAIRRVALS       540
     ILLIVAMVAA TAGLFKHIPS SFLPTEDQGY LLGAVVLPDA ASLDRTGNLS QRAEQWFAKQ       600
     PAVKSVAAPI GYSLIDSQYK SNAGTLFITL KGFKDRGENG TAQDLIRDAN KAFSGYTDGV       660
     VVPLNPPSIP GLGTTGGFEF WLQSTGDGSY QNLEEKVRAF IAKARQNPAL RGVNSTINTN       720
     SRQLLVEVDR ERAESLGVPI QDIYAALQTM FGSSYVSQFP KSSRLFQVIV QAEPQYRTQP       780
     DDIQQLYVRN RSGDMVPIKA VTTVRFVPGA DIVTRFNNFP AAKITGDAAP GHSSGESIAA       840
     MEQIAHEVLG EGYSYAWSGQ AYEEKQAGST AILVFGFALL MVFLILAAQY EKWSLPIGVL       900
     LAVPFAIFGA LIGILLRGME DDVYFQIGLT VLIALAAKNA ILIFEFAVEM REKEALSPYD       960
     AALKAAKLRL RPIIMTSLAF ILGCVPLAIA SGASAASRRS LGTGVIFGML GATVIALFFI      1020
     PMFFWGLETL SSRGKKAPAP DAGPPVSPGP REGGT                                 1055
//

If you have problems or comments...

PBIL Back to PBIL home page