(data stored in ACNUC7421 zone)

EMBL: CP001053.PE158

CP001053.PE158       Location/Qualifiers
FT   CDS             192960..194378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4150"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: rme:Rmet_1703 RND efflux system, outer
FT                   membrane lipoprotein, NodT"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4150"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18533"
FT                   /db_xref="GOA:B2TEL2"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEL2"
FT                   /protein_id="ACD18533.1"
FT                   /translation="MRFPRCRLLAAVCACWFAGCTVGPDYHRPAVDTPSSFRYASPDAE
FT                   VVDQGAVQWWSQFNDPVLDGLIQRALDQNKDLAIAAARVDEFYGRLMTTRAGLFPQVGA
FT                   NFGGGRGRSVPAPGFAPAVGNQVQLDVMASWEIDLFGRLRRLTEAARADYLGTQAAQQA
FT                   TRIALISSVATSYLLLRDLDQRLEIAKSTLASRADALSLFQERFTGGVVSQLQVSQAKS
FT                   EYESAQASVYAFQQQIAQQENALSLLLGDNPGPIPRGKPLTQLSAPAIPAGLPSSLLER
FT                   RPDILQAEQALVSANASIGAARAQYFPSISLTGMFGAASTALSGLWTGPARIWSFAGAI
FT                   SQPIFTGGAITGSVRTAEAQQQEALFSYEQAIQSAFADVENALVGVARVRDQLQATNRQ
FT                   VEALAQYASLARDLYEGGYTSYLEVLDAERSLFNAQLQQSQLQDQQLAEIVALYKALGY
FT                   GWNVDSGSQTPTRG"
     MRFPRCRLLA AVCACWFAGC TVGPDYHRPA VDTPSSFRYA SPDAEVVDQG AVQWWSQFND        60
     PVLDGLIQRA LDQNKDLAIA AARVDEFYGR LMTTRAGLFP QVGANFGGGR GRSVPAPGFA       120
     PAVGNQVQLD VMASWEIDLF GRLRRLTEAA RADYLGTQAA QQATRIALIS SVATSYLLLR       180
     DLDQRLEIAK STLASRADAL SLFQERFTGG VVSQLQVSQA KSEYESAQAS VYAFQQQIAQ       240
     QENALSLLLG DNPGPIPRGK PLTQLSAPAI PAGLPSSLLE RRPDILQAEQ ALVSANASIG       300
     AARAQYFPSI SLTGMFGAAS TALSGLWTGP ARIWSFAGAI SQPIFTGGAI TGSVRTAEAQ       360
     QQEALFSYEQ AIQSAFADVE NALVGVARVR DQLQATNRQV EALAQYASLA RDLYEGGYTS       420
     YLEVLDAERS LFNAQLQQSQ LQDQQLAEIV ALYKALGYGW NVDSGSQTPT RG               472
//

If you have problems or comments...

PBIL Back to PBIL home page