(data stored in ACNUC7421 zone)

EMBL: CP001053.PE159

CP001053.PE159       Location/Qualifiers
FT   CDS             complement(194405..194839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4151"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0566 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4151"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18534"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEL3"
FT                   /protein_id="ACD18534.1"
FT                   /translation="MLCFSLLIAHVAKVFTPMPSSVRNSLIWIFDAFERDPTFISKRMF
FT                   GSDAAYIDGLLCLIAADRDKPWNGLLVCTSHERHAALIHEMPALRPHPVLGKWLYIAQD
FT                   DPAFESAAEELTALVLARDPRIGVEPKPRARGKKSKLPKA"
     MLCFSLLIAH VAKVFTPMPS SVRNSLIWIF DAFERDPTFI SKRMFGSDAA YIDGLLCLIA        60
     ADRDKPWNGL LVCTSHERHA ALIHEMPALR PHPVLGKWLY IAQDDPAFES AAEELTALVL       120
     ARDPRIGVEP KPRARGKKSK LPKA                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page