(data stored in ACNUC7421 zone)

EMBL: CP001053.PE16

CP001053.PE16        Location/Qualifiers
FT   CDS             complement(19762..20049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4005"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0478 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4005"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18391"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE70"
FT                   /protein_id="ACD18391.1"
FT                   /translation="MASITVSDLSLNLALDRKAMTAIRGGGGAPWVYGWIQPYVRDTPS
FT                   IGPVVNLYDVTNNFYANQMINTFQSVDVRNTGANSNISVSPDARSRNDMV"
     MASITVSDLS LNLALDRKAM TAIRGGGGAP WVYGWIQPYV RDTPSIGPVV NLYDVTNNFY        60
     ANQMINTFQS VDVRNTGANS NISVSPDARS RNDMV                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page