(data stored in ACNUC7421 zone)

EMBL: CP001053.PE160

CP001053.PE160       Location/Qualifiers
FT   CDS             complement(194862..195305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4152"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0567 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4152"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18535"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEL4"
FT                   /protein_id="ACD18535.1"
FT                   /translation="MESHPFRVLAALLVSSAGFCPAVSHAYALDAQFDCQARPHTFITQ
FT                   LIDDNYIESKPMRVDKNSVNAFRPVHGSDMTVFGFRVYAVLGYEPDDDMFKKGRGQALA
FT                   GPLYGVVLSAPSESVETRVRAAGSTAKVHSVIPLLLTALICTD"
     MESHPFRVLA ALLVSSAGFC PAVSHAYALD AQFDCQARPH TFITQLIDDN YIESKPMRVD        60
     KNSVNAFRPV HGSDMTVFGF RVYAVLGYEP DDDMFKKGRG QALAGPLYGV VLSAPSESVE       120
     TRVRAAGSTA KVHSVIPLLL TALICTD                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page