(data stored in ACNUC7421 zone)

EMBL: CP001053.PE162

CP001053.PE162       Location/Qualifiers
FT   CDS             complement(196631..197530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4154"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bxe:Bxe_B0570 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4154"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18537"
FT                   /db_xref="GOA:B2TEL6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEL6"
FT                   /protein_id="ACD18537.1"
FT                   /translation="MELKLLRAFLTVAELRHFGHAAEALYVSQPALSKQIVALEASLGA
FT                   RLFERGRHGAELTIFGEGFLADAEALVRDADNILARAREASSGTRGYLRVGLGLSTLTE
FT                   APQLIAQFRKLHPNVSVTLNDLSSAEQSRRLLGGKLDVGFLRLPADAGLSTLPILDEAL
FT                   ALAIPQYARWKRVPSNLQELNEPGFIALSRGRGPGLAAQIDHWCGEHGFVPKVIQQADD
FT                   IQSVLAGVAAGVGAAFLPSRAQYLLRDARVLPLRDAAARWRVALAWQTTRDDPVVANFV
FT                   AFVRAAKKSLRAGSAAPG"
     MELKLLRAFL TVAELRHFGH AAEALYVSQP ALSKQIVALE ASLGARLFER GRHGAELTIF        60
     GEGFLADAEA LVRDADNILA RAREASSGTR GYLRVGLGLS TLTEAPQLIA QFRKLHPNVS       120
     VTLNDLSSAE QSRRLLGGKL DVGFLRLPAD AGLSTLPILD EALALAIPQY ARWKRVPSNL       180
     QELNEPGFIA LSRGRGPGLA AQIDHWCGEH GFVPKVIQQA DDIQSVLAGV AAGVGAAFLP       240
     SRAQYLLRDA RVLPLRDAAA RWRVALAWQT TRDDPVVANF VAFVRAAKKS LRAGSAAPG        299
//

If you have problems or comments...

PBIL Back to PBIL home page