(data stored in ACNUC7421 zone)

EMBL: CP001053.PE164

CP001053.PE164       Location/Qualifiers
FT   CDS             complement(198610..199482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4156"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bxe:Bxe_B0572 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4156"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18539"
FT                   /db_xref="GOA:B2TEL8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEL8"
FT                   /protein_id="ACD18539.1"
FT                   /translation="MEHVDWDDLRILVAIAREGTMRSAAAACDLSAPTLSRRLTELERR
FT                   LGEPLIDRVPSGCSVTAFGAKVLAWAEQMEDLAHQIERAADVNGGAPAHGTVRINAVEW
FT                   PSYILLKLLGSFQDRLPGLAIEVLTSRRPYSLARREADIALWSECPEEGDLYVRRIGKI
FT                   RFGLFGSRDYYLRHKAAIVKKEWDKLSFVGYDDRQPDHPATQWLKALPGAPAPSLRSSY
FT                   GMGVFDGVLGGSGLGILAQLAGDTTSDLVCVEKHIKALDQDVWMVLHPALRDSERIRTV
FT                   ANLIAEIFR"
     MEHVDWDDLR ILVAIAREGT MRSAAAACDL SAPTLSRRLT ELERRLGEPL IDRVPSGCSV        60
     TAFGAKVLAW AEQMEDLAHQ IERAADVNGG APAHGTVRIN AVEWPSYILL KLLGSFQDRL       120
     PGLAIEVLTS RRPYSLARRE ADIALWSECP EEGDLYVRRI GKIRFGLFGS RDYYLRHKAA       180
     IVKKEWDKLS FVGYDDRQPD HPATQWLKAL PGAPAPSLRS SYGMGVFDGV LGGSGLGILA       240
     QLAGDTTSDL VCVEKHIKAL DQDVWMVLHP ALRDSERIRT VANLIAEIFR                  290
//

If you have problems or comments...

PBIL Back to PBIL home page