(data stored in ACNUC7421 zone)

EMBL: CP001053.PE165

CP001053.PE165       Location/Qualifiers
FT   CDS             199674..200639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4157"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: bxe:Bxe_B0573 ABC sugar
FT                   transporter, periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4157"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18540"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEL9"
FT                   /protein_id="ACD18540.1"
FT                   /translation="MIRHFLPARRRAIAAGAAFLAVSILPMPAAFAQAAHKPKVALVMK
FT                   SLANEFFLTMETGAKDYQKQNPAKFDLVTNGIKDETDTANQIRIVEQMIVSKVDALVIA
FT                   PADSKALVPVLKKAVDAGIIVVNIDNKLDNDVLKSKDLNIPFVGPDNAKGAQKVGDYLA
FT                   KHLKSGDNVGIIEGVTTTTNAQQRTAGFKQAMAAGGMKVVALQSGEWEIDKGNAVASQI
FT                   LNANPDVKALLCGNDNMAIGAVSAVRAAGKAGKVQIVGYDDINAIKPMLKDGRVLATAN
FT                   QYAAKQAVFGIDTALKALSEHKKQSELSGVVETPVDLVTK"
     MIRHFLPARR RAIAAGAAFL AVSILPMPAA FAQAAHKPKV ALVMKSLANE FFLTMETGAK        60
     DYQKQNPAKF DLVTNGIKDE TDTANQIRIV EQMIVSKVDA LVIAPADSKA LVPVLKKAVD       120
     AGIIVVNIDN KLDNDVLKSK DLNIPFVGPD NAKGAQKVGD YLAKHLKSGD NVGIIEGVTT       180
     TTNAQQRTAG FKQAMAAGGM KVVALQSGEW EIDKGNAVAS QILNANPDVK ALLCGNDNMA       240
     IGAVSAVRAA GKAGKVQIVG YDDINAIKPM LKDGRVLATA NQYAAKQAVF GIDTALKALS       300
     EHKKQSELSG VVETPVDLVT K                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page