(data stored in ACNUC7421 zone)

EMBL: CP001053.PE167

CP001053.PE167       Location/Qualifiers
FT   CDS             202328..203329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4159"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bxe:Bxe_B0575 ABC sugar transporter, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4159"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18542"
FT                   /db_xref="GOA:B2TEM1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEM1"
FT                   /protein_id="ACD18542.1"
FT                   /translation="MTVETSLPTLQNEPPKNAKPLGTRLGLSNYLGLLGALLGMIVLFS
FT                   LLSSHFLTYDTFSTIANQIPDLVVMSIGMTFVLIIAGIDLSVGSVLALGAALTSVAALQ
FT                   WHWPALPAALLGMAGATLTGCVTGAITVAWRIPSFIVSLGVLEAARGLAYQLTNSRTAY
FT                   IGDAFDFLSNPVAFGISPAFIIAIVVMVAAQFVLTRTVFGRYLVGIGTNEEAVRLAGVN
FT                   PRPYKIAVFAMMGLLAGLASLFQISRLEAADPNAGQGIELQVIAAVVIGGTSLMGGRGS
FT                   VTSTFFGVLIISVLAAGLAQIGATEPTKRIITGAVIVVAVVLDTYRSRRRAG"
     MTVETSLPTL QNEPPKNAKP LGTRLGLSNY LGLLGALLGM IVLFSLLSSH FLTYDTFSTI        60
     ANQIPDLVVM SIGMTFVLII AGIDLSVGSV LALGAALTSV AALQWHWPAL PAALLGMAGA       120
     TLTGCVTGAI TVAWRIPSFI VSLGVLEAAR GLAYQLTNSR TAYIGDAFDF LSNPVAFGIS       180
     PAFIIAIVVM VAAQFVLTRT VFGRYLVGIG TNEEAVRLAG VNPRPYKIAV FAMMGLLAGL       240
     ASLFQISRLE AADPNAGQGI ELQVIAAVVI GGTSLMGGRG SVTSTFFGVL IISVLAAGLA       300
     QIGATEPTKR IITGAVIVVA VVLDTYRSRR RAG                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page