(data stored in ACNUC7421 zone)

EMBL: CP001053.PE17

CP001053.PE17        Location/Qualifiers
FT   CDS             20520..21017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4006"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0479 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4006"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18392"
FT                   /db_xref="InterPro:IPR007053"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE71"
FT                   /protein_id="ACD18392.1"
FT                   /translation="MNTNQTSSEHSADRCDAASTIDLPIGAHLVTQRRGYEHHGIYVGN
FT                   GRVVHYSGFAGSTHRGPVEEVELERFAAGHPLSIRPTPAARYVGDEAVRRARSRLGENH
FT                   YRLLTNNCEHFCAWCLLGESRSEQVHCCLRHPRTGMHALVCLVKAFVESSAKGAHGSAQ
FT                   FA"
     MNTNQTSSEH SADRCDAAST IDLPIGAHLV TQRRGYEHHG IYVGNGRVVH YSGFAGSTHR        60
     GPVEEVELER FAAGHPLSIR PTPAARYVGD EAVRRARSRL GENHYRLLTN NCEHFCAWCL       120
     LGESRSEQVH CCLRHPRTGM HALVCLVKAF VESSAKGAHG SAQFA                       165
//

If you have problems or comments...

PBIL Back to PBIL home page