(data stored in ACNUC7421 zone)

EMBL: CP001053.PE170

CP001053.PE170       Location/Qualifiers
FT   CDS             206098..207810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4162"
FT                   /product="putative CHASE2 sensor protein"
FT                   /note="KEGG: bxe:Bxe_B0577 putative CHASE2 sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4162"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18545"
FT                   /db_xref="GOA:B2TEM4"
FT                   /db_xref="InterPro:IPR007890"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEM4"
FT                   /protein_id="ACD18545.1"
FT                   /translation="MTTQKKKRGPKGEKVEGIEWLHLLGRAALSVLLGLALALVVPTRF
FT                   TEEMGAQTMARYAAPFSGYLFDIERGKAAAKDPVKWNKREITVLAIDREALRARGEGWP
FT                   ARYPFYSWLLGYLNKYRPTGLFIDVILSQPGNKDCNGSGKATGFSGFKKANACYCTNDI
FT                   DDFGDFRQAVTGLISSNVPVFLAARREPDNTLVTNAAIDSDSAFKSLRRVGVEFSAHSV
FT                   DRLAWTYPLVYAGKEPGDIQTTHPVAPSAAAPELLDSSKGQCTASAAFAIFSEVYETEK
FT                   KLIVPCNESKSMSITWPLDTAADGLLWQESADEESEARHGMPRILRADLGDDDEEMYCT
FT                   SSGNLSTLLKRAEVRALFRPSSRPLCVHYRTIHASQLERMSPEDLKKAFSNHFVMIGTS
FT                   FAYSNDLILSPLQDRIPGVFLHAVALDNLLSRGDKLENVEAWELDFHTSANRWGRLLSL
FT                   GAVGFGLIFFTVFLKKEARKKFARFHRERTHWRKPLHWHWWAAKGTTAAFNITLFVTSF
FT                   IVLVAFGVLMILLGNWMLVPFLLISHVLACTIAVEWLEWSEHLFNWITDSKED"
     MTTQKKKRGP KGEKVEGIEW LHLLGRAALS VLLGLALALV VPTRFTEEMG AQTMARYAAP        60
     FSGYLFDIER GKAAAKDPVK WNKREITVLA IDREALRARG EGWPARYPFY SWLLGYLNKY       120
     RPTGLFIDVI LSQPGNKDCN GSGKATGFSG FKKANACYCT NDIDDFGDFR QAVTGLISSN       180
     VPVFLAARRE PDNTLVTNAA IDSDSAFKSL RRVGVEFSAH SVDRLAWTYP LVYAGKEPGD       240
     IQTTHPVAPS AAAPELLDSS KGQCTASAAF AIFSEVYETE KKLIVPCNES KSMSITWPLD       300
     TAADGLLWQE SADEESEARH GMPRILRADL GDDDEEMYCT SSGNLSTLLK RAEVRALFRP       360
     SSRPLCVHYR TIHASQLERM SPEDLKKAFS NHFVMIGTSF AYSNDLILSP LQDRIPGVFL       420
     HAVALDNLLS RGDKLENVEA WELDFHTSAN RWGRLLSLGA VGFGLIFFTV FLKKEARKKF       480
     ARFHRERTHW RKPLHWHWWA AKGTTAAFNI TLFVTSFIVL VAFGVLMILL GNWMLVPFLL       540
     ISHVLACTIA VEWLEWSEHL FNWITDSKED                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page