(data stored in ACNUC7421 zone)

EMBL: CP001053.PE173

CP001053.PE173       Location/Qualifiers
FT   CDS             210328..210588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4165"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18548"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEM7"
FT                   /protein_id="ACD18548.1"
FT                   /translation="MTKFLRTTLIAGLIALPTAAFAQPATPIDEMQVEMVAYEVGGVDL
FT                   TQMSPHTAPAIAIGGTHANASPVELLHPGYDVGLKSIYLRH"
     MTKFLRTTLI AGLIALPTAA FAQPATPIDE MQVEMVAYEV GGVDLTQMSP HTAPAIAIGG        60
     THANASPVEL LHPGYDVGLK SIYLRH                                             86
//

If you have problems or comments...

PBIL Back to PBIL home page