(data stored in ACNUC7421 zone)

EMBL: CP001053.PE174

CP001053.PE174       Location/Qualifiers
FT   CDS             complement(210607..211944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4166"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: pol:Bpro_3675
FT                   periplasmic sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4166"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18549"
FT                   /db_xref="GOA:B2TEM8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEM8"
FT                   /protein_id="ACD18549.1"
FT                   /translation="MLKSLRNQLVIALGAVVSLFAILQGVSSYQFCVAGMSAVLDLRME
FT                   QVASRLRVGFGEGIPTVPARGSQDARDIFIVMWKDGETQPVRTTEPSLLLPRNAVEGFS
FT                   SPIVNGEGWRIYTARDGAQTVQVAQRLSVRHEIEETAATKTLWPIVVLIPLVWAAVIFV
FT                   VSRSLRELNRLGNKVRDIDVNHLQALPLARVPTELLPFIRSINLMIERLARSIESERKF
FT                   ISDAAHELRTPLTALQLQADNLQRDVMPSNQERFRALQGGIARSSNLISQLLRLARADA
FT                   PPVGQSMTRAMISVDVSAAVVNAISDVLPIAMQRGIDIGADEMVSAKVRAIELDIGTVI
FT                   KNLVSNAVRYTPDGGTIDLSTRVHDGMVSVEVKDTGSGIDETLLPRVFDRFFRANTDIE
FT                   GSGLGLSIVKAIVTRYGGTVTLRNRDDGQSGIVATVSLPIEPDGAG"
     MLKSLRNQLV IALGAVVSLF AILQGVSSYQ FCVAGMSAVL DLRMEQVASR LRVGFGEGIP        60
     TVPARGSQDA RDIFIVMWKD GETQPVRTTE PSLLLPRNAV EGFSSPIVNG EGWRIYTARD       120
     GAQTVQVAQR LSVRHEIEET AATKTLWPIV VLIPLVWAAV IFVVSRSLRE LNRLGNKVRD       180
     IDVNHLQALP LARVPTELLP FIRSINLMIE RLARSIESER KFISDAAHEL RTPLTALQLQ       240
     ADNLQRDVMP SNQERFRALQ GGIARSSNLI SQLLRLARAD APPVGQSMTR AMISVDVSAA       300
     VVNAISDVLP IAMQRGIDIG ADEMVSAKVR AIELDIGTVI KNLVSNAVRY TPDGGTIDLS       360
     TRVHDGMVSV EVKDTGSGID ETLLPRVFDR FFRANTDIEG SGLGLSIVKA IVTRYGGTVT       420
     LRNRDDGQSG IVATVSLPIE PDGAG                                             445
//

If you have problems or comments...

PBIL Back to PBIL home page