(data stored in ACNUC7421 zone)

EMBL: CP001053.PE175

CP001053.PE175       Location/Qualifiers
FT   CDS             complement(212053..212787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4167"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bxe:Bxe_B0580
FT                   putative transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4167"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18550"
FT                   /db_xref="GOA:B2TEM9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEM9"
FT                   /protein_id="ACD18550.1"
FT                   /translation="MKEATSRRKTSAPLKTPAPAHTSTDHASREKPYHHGALPHALLEA
FT                   AEVVLRRDGIRGLTLRAIAREAGVSHTAPQHHFGDTAGVLSELAASGHRRLAATMAEQA
FT                   DGIEAGQARRKAIARGYVSFAVANPDLLHLMSRNEMLDAQRPALVQARLASARALAGVV
FT                   IAPTDHAEEDKSSFGRITAAQATAMTAAWAYVHGLALLLIDGRLNALAASADGIRSAED
FT                   LVEAAIEHVQIVPAYPTGKGRK"
     MKEATSRRKT SAPLKTPAPA HTSTDHASRE KPYHHGALPH ALLEAAEVVL RRDGIRGLTL        60
     RAIAREAGVS HTAPQHHFGD TAGVLSELAA SGHRRLAATM AEQADGIEAG QARRKAIARG       120
     YVSFAVANPD LLHLMSRNEM LDAQRPALVQ ARLASARALA GVVIAPTDHA EEDKSSFGRI       180
     TAAQATAMTA AWAYVHGLAL LLIDGRLNAL AASADGIRSA EDLVEAAIEH VQIVPAYPTG       240
     KGRK                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page