(data stored in ACNUC7421 zone)

EMBL: CP001053.PE176

CP001053.PE176       Location/Qualifiers
FT   CDS             complement(212852..213016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4168"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4168"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18551"
FT                   /db_xref="GOA:B2TEN0"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEN0"
FT                   /protein_id="ACD18551.1"
FT                   /translation="MVDVLEWLIDISVASANAAATGSIFLLLVGVAGETRRHVVKRREA
FT                   PQRNALARL"
     MVDVLEWLID ISVASANAAA TGSIFLLLVG VAGETRRHVV KRREAPQRNA LARL              54
//

If you have problems or comments...

PBIL Back to PBIL home page