(data stored in ACNUC7421 zone)

EMBL: CP001053.PE18

CP001053.PE18        Location/Qualifiers
FT   CDS             21085..21342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4007"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0480 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4007"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18393"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE72"
FT                   /protein_id="ACD18393.1"
FT                   /translation="MAAAEKTLHWAVDKWLAPTPSMPARVVQFCHRASQHQRYVCVEAL
FT                   RPGGMLSIFFFRHDDGSWNVFPPQAERPAMNGHRRALLAA"
     MAAAEKTLHW AVDKWLAPTP SMPARVVQFC HRASQHQRYV CVEALRPGGM LSIFFFRHDD        60
     GSWNVFPPQA ERPAMNGHRR ALLAA                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page