(data stored in ACNUC7421 zone)

EMBL: CP001053.PE181

CP001053.PE181       Location/Qualifiers
FT   CDS             217467..218765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4173"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: bxe:Bxe_C1347 putative mandelate
FT                   racemase/muconate lactonizing enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4173"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18556"
FT                   /db_xref="GOA:B2TEN5"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034610"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEN5"
FT                   /protein_id="ACD18556.1"
FT                   /translation="MPTITRLSVRDIRFPTSRSLDGSDAMNAAPDYSAAYVTLETDSPD
FT                   ALTGHGLTFTIGRGNEICVAAVEALAPLIVGKRLEDIAANMGAFWRALTSDSQLRWIGP
FT                   DKGAIHLATAAVVNAAWDLWAKAEGKPVWKLLVDMSPEELVRCLDFRYVTDAITPQEAI
FT                   AMLHRHAKTRGEREKEMLAQGYPAYTTSAGWLGYDDDKIRRLAREGVAQGWTHFKQKVG
FT                   GNLDEDMRRARILREEIGEDRKLMMDANQVWDVDEAVANMRRLAQFDPWWIEEPTSPDD
FT                   ILGHAAIRQRLRQIGVATGEHCHNRVMFKQLLQAQAIDFCQVDSCRLGGLNEVIVVLLM
FT                   AAKFGVPVCPHAGGVGLCEYVQHISLFDYICVSASLENRVLEYVDHLHEHFVDPVVIRN
FT                   GRYMPPQRSGYSIEMHAASLDEYDFPEGVAWRG"
     MPTITRLSVR DIRFPTSRSL DGSDAMNAAP DYSAAYVTLE TDSPDALTGH GLTFTIGRGN        60
     EICVAAVEAL APLIVGKRLE DIAANMGAFW RALTSDSQLR WIGPDKGAIH LATAAVVNAA       120
     WDLWAKAEGK PVWKLLVDMS PEELVRCLDF RYVTDAITPQ EAIAMLHRHA KTRGEREKEM       180
     LAQGYPAYTT SAGWLGYDDD KIRRLAREGV AQGWTHFKQK VGGNLDEDMR RARILREEIG       240
     EDRKLMMDAN QVWDVDEAVA NMRRLAQFDP WWIEEPTSPD DILGHAAIRQ RLRQIGVATG       300
     EHCHNRVMFK QLLQAQAIDF CQVDSCRLGG LNEVIVVLLM AAKFGVPVCP HAGGVGLCEY       360
     VQHISLFDYI CVSASLENRV LEYVDHLHEH FVDPVVIRNG RYMPPQRSGY SIEMHAASLD       420
     EYDFPEGVAW RG                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page