(data stored in ACNUC7421 zone)

EMBL: CP001053.PE183

CP001053.PE183       Location/Qualifiers
FT   CDS             complement(220027..221211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4176"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: ecm:EcSMS35_4680 AP endonuclease, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4176"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18558"
FT                   /db_xref="GOA:B2TEN7"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR013097"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEN7"
FT                   /protein_id="ACD18558.1"
FT                   /translation="MSRPTGPVRHMVFCRFRADVTPARRLAFFEQIRRLTEVPGIAFTN
FT                   FQCGPNVSPEGYGMNFADGFMMDFESGQPASRISPIRRIRRSARVCSKRSMAARKACSY
FT                   SISIWKLMRNLQGRLDLCSINTATLGHREPLSRTIDRIAKAGFGGIAPWRREVEEADLV
FT                   QIARQIKALDLTVTGYCRSTYLPAATSAEFKANVEANRAALRDAAILGARCFVMVVGGL
FT                   PEGSRDLDGARNQVSEGIEMLLETARDCGVPLALEPLHPVYAADRAVLNTIAQALEICE
FT                   RVDRDRSGMLGVAVDVYHCWWDPALTASIEAAGRAGRILAYHACDWLRETRDVLLDRGM
FT                   MGDGVIDLPAVRQTIESAGYEGLVEVEIFSAQDWWLRDPDEVLAICADRLQNFC"
     MSRPTGPVRH MVFCRFRADV TPARRLAFFE QIRRLTEVPG IAFTNFQCGP NVSPEGYGMN        60
     FADGFMMDFE SGQPASRISP IRRIRRSARV CSKRSMAARK ACSYSISIWK LMRNLQGRLD       120
     LCSINTATLG HREPLSRTID RIAKAGFGGI APWRREVEEA DLVQIARQIK ALDLTVTGYC       180
     RSTYLPAATS AEFKANVEAN RAALRDAAIL GARCFVMVVG GLPEGSRDLD GARNQVSEGI       240
     EMLLETARDC GVPLALEPLH PVYAADRAVL NTIAQALEIC ERVDRDRSGM LGVAVDVYHC       300
     WWDPALTASI EAAGRAGRIL AYHACDWLRE TRDVLLDRGM MGDGVIDLPA VRQTIESAGY       360
     EGLVEVEIFS AQDWWLRDPD EVLAICADRL QNFC                                   394
//

If you have problems or comments...

PBIL Back to PBIL home page