(data stored in ACNUC7421 zone)

EMBL: CP001053.PE19

CP001053.PE19        Location/Qualifiers
FT   CDS             complement(21339..22217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4008"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bxe:Bxe_B0481 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4008"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18394"
FT                   /db_xref="GOA:B2TE73"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037422"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE73"
FT                   /protein_id="ACD18394.1"
FT                   /translation="MRPYLPLNALRAFESSARHLSFTRAAFELNVTQAAVSQQVRTLEE
FT                   RLGTALFKRLPRGLAMTDEGLALRPVLTDAFDRIEAVLKQFEGGHFHEVLTVGVVGTFA
FT                   VGWLMPRLKSFRDAHPFVELRLLTNNNLVDLATEGLDFAIRFGDGTWPGSLATRLLDAP
FT                   LALLCTPEIAERLTKPEDLAGETLLRSYRTDDWMSWFSAAGIPPRPIRGPVFDSSRLMV
FT                   EAAMQGAGIALAPALMFDHEINTGRLVRPFDVEVHAGSYWLTWLKGKPMTPAMLLFNQW
FT                   IIKEASAQTQN"
     MRPYLPLNAL RAFESSARHL SFTRAAFELN VTQAAVSQQV RTLEERLGTA LFKRLPRGLA        60
     MTDEGLALRP VLTDAFDRIE AVLKQFEGGH FHEVLTVGVV GTFAVGWLMP RLKSFRDAHP       120
     FVELRLLTNN NLVDLATEGL DFAIRFGDGT WPGSLATRLL DAPLALLCTP EIAERLTKPE       180
     DLAGETLLRS YRTDDWMSWF SAAGIPPRPI RGPVFDSSRL MVEAAMQGAG IALAPALMFD       240
     HEINTGRLVR PFDVEVHAGS YWLTWLKGKP MTPAMLLFNQ WIIKEASAQT QN               292
//

If you have problems or comments...

PBIL Back to PBIL home page