(data stored in ACNUC7421 zone)

EMBL: CP001053.PE198

CP001053.PE198       Location/Qualifiers
FT   CDS             complement(238054..239127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4191"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; Rhodanese
FT                   domain protein; KEGG: bur:Bcep18194_B0182
FT                   beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4191"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18573"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="PDB:5VE3"
FT                   /db_xref="PDB:5VE4"
FT                   /db_xref="PDB:5VE5"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEQ2"
FT                   /protein_id="ACD18573.1"
FT                   /translation="MLIFRQLFDQQSSTYTYLLADSTTREAVLIDPVFEQVRRDAALIE
FT                   ELGLHLLYTIDTHVHADHVTGAWMLNRRIGSRIAISAASGAEGADRYLSHGDKVEFGTR
FT                   YLTVRATPGHTDGCITLVLDNETMAFTGDCLLIRGTGRTDFQRGDAHTMFRAVHGQIFT
FT                   LPTACLLYPAHDYRGLTVTSVGEERRFNPRLGGELCEEDFTGYMTNLHLPHPKQIDVAV
FT                   PANLKCGLAASVPTQMTEPDWAPLTCSFAGIWEINAQWLEENLRAVEIVDVREPEEFNG
FT                   PLGRIPAARLISLGELAGRTAELTKDRPIVTVCRAGGRSAQATVMLRQAGFERVANLPG
FT                   GMLRWRAEGRVVENGSV"
     MLIFRQLFDQ QSSTYTYLLA DSTTREAVLI DPVFEQVRRD AALIEELGLH LLYTIDTHVH        60
     ADHVTGAWML NRRIGSRIAI SAASGAEGAD RYLSHGDKVE FGTRYLTVRA TPGHTDGCIT       120
     LVLDNETMAF TGDCLLIRGT GRTDFQRGDA HTMFRAVHGQ IFTLPTACLL YPAHDYRGLT       180
     VTSVGEERRF NPRLGGELCE EDFTGYMTNL HLPHPKQIDV AVPANLKCGL AASVPTQMTE       240
     PDWAPLTCSF AGIWEINAQW LEENLRAVEI VDVREPEEFN GPLGRIPAAR LISLGELAGR       300
     TAELTKDRPI VTVCRAGGRS AQATVMLRQA GFERVANLPG GMLRWRAEGR VVENGSV          357
//

If you have problems or comments...

PBIL Back to PBIL home page