(data stored in ACNUC7421 zone)

EMBL: CP001053.PE199

CP001053.PE199       Location/Qualifiers
FT   CDS             complement(239273..239929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4192"
FT                   /product="Peroxidase"
FT                   /EC_number="1.11.1.7"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   bur:Bcep18194_B0181 peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4192"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18574"
FT                   /db_xref="GOA:B2TEQ3"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEQ3"
FT                   /protein_id="ACD18574.1"
FT                   /translation="MSIRLGEDAPDFTAETTEGTIHFHEWIGDHWAVLFSHPKDFTPVC
FT                   TTELGYLAGLKPEFDKRNTKIIGLSVDPVSDHTEWVKDIAETQGHAINYPLIGDSDLKV
FT                   AKLYDMIHPEASGGGPRTAVDNATVRSVFLIGPDKKVKAMLVYPMSAGRNFDEVLRLLD
FT                   ALQLNAKHTVATPVNWKPGEDVIIPTSVSNDAATQKYPQGFKTVKPYLRYVAQPK"
     MSIRLGEDAP DFTAETTEGT IHFHEWIGDH WAVLFSHPKD FTPVCTTELG YLAGLKPEFD        60
     KRNTKIIGLS VDPVSDHTEW VKDIAETQGH AINYPLIGDS DLKVAKLYDM IHPEASGGGP       120
     RTAVDNATVR SVFLIGPDKK VKAMLVYPMS AGRNFDEVLR LLDALQLNAK HTVATPVNWK       180
     PGEDVIIPTS VSNDAATQKY PQGFKTVKPY LRYVAQPK                               218
//

If you have problems or comments...

PBIL Back to PBIL home page