(data stored in ACNUC7421 zone)

EMBL: CP001053.PE2

CP001053.PE2         Location/Qualifiers
FT   CDS             complement(663..947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_3991"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0448 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_3991"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18377"
FT                   /db_xref="UniProtKB/TrEMBL:B2TAL8"
FT                   /protein_id="ACD18377.1"
FT                   /translation="MSSLMIRDLSGTRELDRRAMSAVAGGTGSSVPGLPSVAGLGGIAN
FT                   VNVSINQNLNQMQYVNVAALNNVGVIGAGFVPLHLNVSPSLWGANNATV"
     MSSLMIRDLS GTRELDRRAM SAVAGGTGSS VPGLPSVAGL GGIANVNVSI NQNLNQMQYV        60
     NVAALNNVGV IGAGFVPLHL NVSPSLWGAN NATV                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page