(data stored in ACNUC7421 zone)

EMBL: CP001053.PE202

CP001053.PE202       Location/Qualifiers
FT   CDS             242363..242686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4195"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B3177 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4195"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18577"
FT                   /db_xref="GOA:B2TEQ6"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEQ6"
FT                   /protein_id="ACD18577.1"
FT                   /translation="MMFRGLCKVVAIAFVTNQALTTIFTYFVQQLDSAPPHQAVWIFSC
FT                   VTCGMVTLWLQADARRAFGFAREKGFVKKSGEDTQGVQIADDCPKRWLVVLHIELNPAS
FT                   IQG"
     MMFRGLCKVV AIAFVTNQAL TTIFTYFVQQ LDSAPPHQAV WIFSCVTCGM VTLWLQADAR        60
     RAFGFAREKG FVKKSGEDTQ GVQIADDCPK RWLVVLHIEL NPASIQG                     107
//

If you have problems or comments...

PBIL Back to PBIL home page