(data stored in ACNUC7421 zone)

EMBL: CP001053.PE203

CP001053.PE203       Location/Qualifiers
FT   CDS             complement(242720..243685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4196"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase NAD-binding; KEGG: sen:SACE_1944 D-isomer
FT                   specific 2-hydroxyacid dehydrogenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4196"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18578"
FT                   /db_xref="GOA:B2TEQ7"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEQ7"
FT                   /protein_id="ACD18578.1"
FT                   /translation="MNDKSLIKVAVLDDYQNVALSMADWSPLTNRAEVTVFNDHVADIG
FT                   NLIQRLQPFDVICAMRERTPLPREVIESLPNLKLIASTGAGNTSIDQDAAAERGIEIRH
FT                   TGYSSTPTIEMTWALILAMARNIPLENQSVRQGGWQLSLGDELAGKTLGLLGLGRVGSA
FT                   VGIIGRAFRMNVVAWSQNLTEERAAEKGVQRVSKDELFSTADFLSIHVRLGERTTGLVG
FT                   AAEFAQMKPTSRLINTSRGPIVDSAALLTALTTGQITGAALDVYDVEPLDNPHPLRELP
FT                   NVLATPHIGYVSKELYRTFYGDTVRNIVQWLDESGGSARG"
     MNDKSLIKVA VLDDYQNVAL SMADWSPLTN RAEVTVFNDH VADIGNLIQR LQPFDVICAM        60
     RERTPLPREV IESLPNLKLI ASTGAGNTSI DQDAAAERGI EIRHTGYSST PTIEMTWALI       120
     LAMARNIPLE NQSVRQGGWQ LSLGDELAGK TLGLLGLGRV GSAVGIIGRA FRMNVVAWSQ       180
     NLTEERAAEK GVQRVSKDEL FSTADFLSIH VRLGERTTGL VGAAEFAQMK PTSRLINTSR       240
     GPIVDSAALL TALTTGQITG AALDVYDVEP LDNPHPLREL PNVLATPHIG YVSKELYRTF       300
     YGDTVRNIVQ WLDESGGSAR G                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page