(data stored in ACNUC7421 zone)

EMBL: CP001053.PE204

CP001053.PE204       Location/Qualifiers
FT   CDS             complement(243740..244396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4197"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18579"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEQ8"
FT                   /protein_id="ACD18579.1"
FT                   /translation="MPCRCLRSTCWHFFGCRCQAAALLRCMVFTSNFDVQENSGKDSTA
FT                   VWRWRREAAGRQVRAGTYSPTEPRRLLRSDSALQTDVRSGIATNAASSRFRSSGRLDSP
FT                   VIFPANFRFRIRPLPDSTDAARTVPHATRSTGTRPGKFGRPTSQKRRRPRQQPRPNRTA
FT                   ACRCSRIVSRADLSVICIWTDYDSDGRHRIYRLRWLGERLWPVSLNHSASWTTRS"
     MPCRCLRSTC WHFFGCRCQA AALLRCMVFT SNFDVQENSG KDSTAVWRWR REAAGRQVRA        60
     GTYSPTEPRR LLRSDSALQT DVRSGIATNA ASSRFRSSGR LDSPVIFPAN FRFRIRPLPD       120
     STDAARTVPH ATRSTGTRPG KFGRPTSQKR RRPRQQPRPN RTAACRCSRI VSRADLSVIC       180
     IWTDYDSDGR HRIYRLRWLG ERLWPVSLNH SASWTTRS                               218
//

If you have problems or comments...

PBIL Back to PBIL home page