(data stored in ACNUC7421 zone)

EMBL: CP001053.PE208

CP001053.PE208       Location/Qualifiers
FT   CDS             246679..247119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4201"
FT                   /product="nuclear protein SET"
FT                   /note="PFAM: nuclear protein SET; KEGG: bxe:Bxe_C1219
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4201"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18583"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniProtKB/TrEMBL:B2TER2"
FT                   /protein_id="ACD18583.1"
FT                   /translation="MRRVIVRRSSVHGKGVFAMRPLAAGECVLEYRGELTSWREAVRRH
FT                   RREGVAGHTFLFGLSDGRVIDGSRGGNSARWLNHACAPNCETVEDDGRIFIHTIRPIEA
FT                   GEELFIEYLLATDDPLDEDVRAQYACRCAVVGCRRSMLAAVT"
     MRRVIVRRSS VHGKGVFAMR PLAAGECVLE YRGELTSWRE AVRRHRREGV AGHTFLFGLS        60
     DGRVIDGSRG GNSARWLNHA CAPNCETVED DGRIFIHTIR PIEAGEELFI EYLLATDDPL       120
     DEDVRAQYAC RCAVVGCRRS MLAAVT                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page