(data stored in ACNUC7421 zone)

EMBL: CP001053.PE209

CP001053.PE209       Location/Qualifiers
FT   CDS             complement(247214..247465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4202"
FT                   /product="Transglycosylase-associated protein"
FT                   /note="PFAM: Transglycosylase-associated protein; KEGG:
FT                   reh:H16_B2506 hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4202"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18584"
FT                   /db_xref="GOA:B2TER3"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:B2TER3"
FT                   /protein_id="ACD18584.1"
FT                   /translation="MLSFIGTLIVGLVVGLIARAVKPGDDRMGLIMTIVLGIAGSLIAG
FT                   YVGRALGWYQPGQAAGWVASIIGAIILLVIYGLVRRRS"
     MLSFIGTLIV GLVVGLIARA VKPGDDRMGL IMTIVLGIAG SLIAGYVGRA LGWYQPGQAA        60
     GWVASIIGAI ILLVIYGLVR RRS                                                83
//

If you have problems or comments...

PBIL Back to PBIL home page