(data stored in ACNUC7421 zone)

EMBL: CP001053.PE21

CP001053.PE21        Location/Qualifiers
FT   CDS             23311..23556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4010"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_4229 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4010"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18396"
FT                   /db_xref="GOA:B2TE75"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE75"
FT                   /protein_id="ACD18396.1"
FT                   /translation="MTDAPIEVRDDTPLAFLGFTATPHIFTVLAIVELIADQLPKPLAI
FT                   PCRCNSARVSCLAASGVTRRRGADRHGVALMYFRKM"
     MTDAPIEVRD DTPLAFLGFT ATPHIFTVLA IVELIADQLP KPLAIPCRCN SARVSCLAAS        60
     GVTRRRGADR HGVALMYFRK M                                                  81
//

If you have problems or comments...

PBIL Back to PBIL home page