(data stored in ACNUC7421 zone)

EMBL: CP001053.PE215

CP001053.PE215       Location/Qualifiers
FT   CDS             complement(255446..255994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4209"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: ferredoxin; [2Fe-2S]-binding domain protein;
FT                   KEGG: bxe:Bxe_C1223 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4209"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18590"
FT                   /db_xref="GOA:B2TER9"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:B2TER9"
FT                   /protein_id="ACD18590.1"
FT                   /translation="MMQQTASKTPQQSADPDAVRTTRQPSANATMPVELTVNGNLYTLS
FT                   LDPRTTLLDALREHLHLTGTKKGCDHGQCGACTVHVNGRRVNACLLLACAHAGDEITTI
FT                   EGIGQPEALHPMQAAFVECDGYQCGYCTSGQIMSAVALLGEAVGPDDAEVREAMSGNLC
FT                   RCGAYQNIVAAIQRVRGQS"
     MMQQTASKTP QQSADPDAVR TTRQPSANAT MPVELTVNGN LYTLSLDPRT TLLDALREHL        60
     HLTGTKKGCD HGQCGACTVH VNGRRVNACL LLACAHAGDE ITTIEGIGQP EALHPMQAAF       120
     VECDGYQCGY CTSGQIMSAV ALLGEAVGPD DAEVREAMSG NLCRCGAYQN IVAAIQRVRG       180
     QS                                                                      182
//

If you have problems or comments...

PBIL Back to PBIL home page