(data stored in ACNUC7421 zone)

EMBL: CP001053.PE216

CP001053.PE216       Location/Qualifiers
FT   CDS             complement(256392..257069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4210"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein; KEGG: sme:SMb20212
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4210"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18591"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B2TES0"
FT                   /protein_id="ACD18591.1"
FT                   /translation="MKILLVLTSHNVLGDTGKPTGFWLEEFTAPYYAFTDAGAEVTVAS
FT                   PKGGQPPIDPKSDDPDNQTDTMLRFKKDPATQKALANSVKLADVKAADYDTIFYAGGHG
FT                   PMWDLTNDKNSIALIEDFYNAGKPVAAVCHGPCVLFKATYEGQPLVKGKRVTGFTNDEE
FT                   EAVGLTKVVPFLVEDELKRLGGHFEKVENWAVLTVVDGRLITGQNPASSGPTAKELLKV
FT                   LQA"
     MKILLVLTSH NVLGDTGKPT GFWLEEFTAP YYAFTDAGAE VTVASPKGGQ PPIDPKSDDP        60
     DNQTDTMLRF KKDPATQKAL ANSVKLADVK AADYDTIFYA GGHGPMWDLT NDKNSIALIE       120
     DFYNAGKPVA AVCHGPCVLF KATYEGQPLV KGKRVTGFTN DEEEAVGLTK VVPFLVEDEL       180
     KRLGGHFEKV ENWAVLTVVD GRLITGQNPA SSGPTAKELL KVLQA                       225
//

If you have problems or comments...

PBIL Back to PBIL home page