(data stored in ACNUC7421 zone)

EMBL: CP001053.PE217

CP001053.PE217       Location/Qualifiers
FT   CDS             257654..257941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4211"
FT                   /product="protein of unknown function DUF1330"
FT                   /note="PFAM: protein of unknown function DUF1330; KEGG:
FT                   bur:Bcep18194_C7348 protein of unknown function DUF1330"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4211"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18592"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B2TES1"
FT                   /protein_id="ACD18592.1"
FT                   /translation="MATYIVFTKESTQDQAELDIYQSKVGETFKGHPVTVLAAYGPQQV
FT                   LEGDAPEGVVIVQFPSTEAARAWYDSPAYQEVAQHRFKGARYRAVLVEGV"
     MATYIVFTKE STQDQAELDI YQSKVGETFK GHPVTVLAAY GPQQVLEGDA PEGVVIVQFP        60
     STEAARAWYD SPAYQEVAQH RFKGARYRAV LVEGV                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page