(data stored in ACNUC7421 zone)

EMBL: CP001053.PE22

CP001053.PE22        Location/Qualifiers
FT   CDS             complement(23615..24631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4011"
FT                   /product="C4-dicarboxylate transporter/malic acid transport
FT                   protein"
FT                   /note="PFAM: C4-dicarboxylate transporter/malic acid
FT                   transport protein; KEGG: bxe:Bxe_B0482 potassium-tellurite
FT                   ethidium and proflavin transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4011"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18397"
FT                   /db_xref="GOA:B2TE76"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="InterPro:IPR038665"
FT                   /db_xref="InterPro:IPR039264"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE76"
FT                   /protein_id="ACD18397.1"
FT                   /translation="MNSNRGTIPVAFFGIAVGALAFANLWRVAIRLWHLPALAGDAITV
FT                   AALAVWLVILVAYGQKWLTRADEARAEIQHPVQSSFAALAPISSLLAAQLLQPYAHTLA
FT                   LALYGVAVVAQLALGMYLHGRLWQGGRKPELVTPAIYLPTVGASFVAGTASAAFGFHQL
FT                   GELFFGVGLLSWLAIESLVLHRAAVHEPLPDALRPVLGIQLAPPVVGGVTYLSLSSGTP
FT                   DLFAMILLGYGLYQALLLLRLLPWIRQQAFTPAYWAFSFGVAALPTMALRMVERGATGP
FT                   VEYAAPVLFIAANVIIAILAVKTLSLLMRGKLIPATPVTGALSAPQTPAGSRIARAS"
     MNSNRGTIPV AFFGIAVGAL AFANLWRVAI RLWHLPALAG DAITVAALAV WLVILVAYGQ        60
     KWLTRADEAR AEIQHPVQSS FAALAPISSL LAAQLLQPYA HTLALALYGV AVVAQLALGM       120
     YLHGRLWQGG RKPELVTPAI YLPTVGASFV AGTASAAFGF HQLGELFFGV GLLSWLAIES       180
     LVLHRAAVHE PLPDALRPVL GIQLAPPVVG GVTYLSLSSG TPDLFAMILL GYGLYQALLL       240
     LRLLPWIRQQ AFTPAYWAFS FGVAALPTMA LRMVERGATG PVEYAAPVLF IAANVIIAIL       300
     AVKTLSLLMR GKLIPATPVT GALSAPQTPA GSRIARAS                               338
//

If you have problems or comments...

PBIL Back to PBIL home page