(data stored in ACNUC7421 zone)

EMBL: CP001053.PE222

CP001053.PE222       Location/Qualifiers
FT   CDS             complement(261686..262444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4216"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: bam:Bamb_4042 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4216"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18597"
FT                   /db_xref="GOA:B2TES6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TES6"
FT                   /protein_id="ACD18597.1"
FT                   /translation="MPASKKFAAVTGAGSGIGRAAAVALANAGFAVALIGRRTEPLLET
FT                   KETIGMAGGEAHVFQADVADAASVEQAFSRIAEAFGRLDVLFNNAGRNAGAVPLEDYDA
FT                   DFWNDVVATNLTGVFLCARSAYRLMKAQSPQGGRIINNGSISAHSPRPHTIAYTATKHA
FT                   VTGITRSIALDGRAFNIACGQIDIGNAATSLTERMNRGVMQADGRVAPEARMDVTHVAN
FT                   AVVHMASLPLEANVLNMTIMASAMPFVGRG"
     MPASKKFAAV TGAGSGIGRA AAVALANAGF AVALIGRRTE PLLETKETIG MAGGEAHVFQ        60
     ADVADAASVE QAFSRIAEAF GRLDVLFNNA GRNAGAVPLE DYDADFWNDV VATNLTGVFL       120
     CARSAYRLMK AQSPQGGRII NNGSISAHSP RPHTIAYTAT KHAVTGITRS IALDGRAFNI       180
     ACGQIDIGNA ATSLTERMNR GVMQADGRVA PEARMDVTHV ANAVVHMASL PLEANVLNMT       240
     IMASAMPFVG RG                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page