(data stored in ACNUC7421 zone)

EMBL: CP001053.PE223

CP001053.PE223       Location/Qualifiers
FT   CDS             262759..263721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4217"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase NAD-binding; KEGG: bam:Bamb_6378 D-isomer
FT                   specific 2-hydroxyacid dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4217"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18598"
FT                   /db_xref="GOA:B2TES7"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TES7"
FT                   /protein_id="ACD18598.1"
FT                   /translation="MSENNRTRLLIARKVPTAVANRAEAEFHAFVTESDMDAWSVVDFC
FT                   KKHATPAVLIGKKSGLQAEHIAALPSTVKIIANASAGFDHMDVAAARERGIVVTNAPDA
FT                   LTECTADFSLLLVLAACRRASEYERIMRNGWGKSFGMTEMLGTRVNGKTLGIVGFGRIG
FT                   RAVAKRAQGFGMRVIYTDINRAAASLENGATFYNSLDEMLPHCQVLTLHVPGGGVPLMT
FT                   KREFALLPAGAVFVNAARGALVDEDALYEALTSGHLFGAGLDVYRNEPNVDKRFAGLDN
FT                   VFLTPHMASATMETRDQMGFTALDNVAAVLNERPALNPV"
     MSENNRTRLL IARKVPTAVA NRAEAEFHAF VTESDMDAWS VVDFCKKHAT PAVLIGKKSG        60
     LQAEHIAALP STVKIIANAS AGFDHMDVAA ARERGIVVTN APDALTECTA DFSLLLVLAA       120
     CRRASEYERI MRNGWGKSFG MTEMLGTRVN GKTLGIVGFG RIGRAVAKRA QGFGMRVIYT       180
     DINRAAASLE NGATFYNSLD EMLPHCQVLT LHVPGGGVPL MTKREFALLP AGAVFVNAAR       240
     GALVDEDALY EALTSGHLFG AGLDVYRNEP NVDKRFAGLD NVFLTPHMAS ATMETRDQMG       300
     FTALDNVAAV LNERPALNPV                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page