(data stored in ACNUC7421 zone)

EMBL: CP001053.PE224

CP001053.PE224       Location/Qualifiers
FT   CDS             complement(263954..264427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4218"
FT                   /product="PRC-barrel domain protein"
FT                   /note="PFAM: PRC-barrel domain protein; KEGG: bxe:Bxe_B2570
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4218"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18599"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:B2TES8"
FT                   /protein_id="ACD18599.1"
FT                   /translation="MGSINPQGDTRRGAEIVGGGMGEGPGPDIMAAATLDGNKVMSSDG
FT                   EHVGKISDIMLDVRNGRIAYAVLSEGGFLGMGSTLHAIPWSALTLDTDEKCFIVDITAQ
FT                   RLKDDPGFDKDHWPTMADAKWGESTYSYYNRQPYWSATHDVVESDPAIRPSEH"
     MGSINPQGDT RRGAEIVGGG MGEGPGPDIM AAATLDGNKV MSSDGEHVGK ISDIMLDVRN        60
     GRIAYAVLSE GGFLGMGSTL HAIPWSALTL DTDEKCFIVD ITAQRLKDDP GFDKDHWPTM       120
     ADAKWGESTY SYYNRQPYWS ATHDVVESDP AIRPSEH                                157
//

If you have problems or comments...

PBIL Back to PBIL home page