(data stored in ACNUC7421 zone)

EMBL: CP001053.PE225

CP001053.PE225       Location/Qualifiers
FT   CDS             complement(264498..264728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4219"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bte:BTH_II0963 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4219"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18600"
FT                   /db_xref="UniProtKB/TrEMBL:B2TES9"
FT                   /protein_id="ACD18600.1"
FT                   /translation="MQILPNTPATRISSHRGYGLRASTTPTGDGLHSADLVIEQPGRPP
FT                   RAFASLDLFYDHEQAMQYATVWGRIWVDSKT"
     MQILPNTPAT RISSHRGYGL RASTTPTGDG LHSADLVIEQ PGRPPRAFAS LDLFYDHEQA        60
     MQYATVWGRI WVDSKT                                                        76
//

If you have problems or comments...

PBIL Back to PBIL home page