(data stored in ACNUC7421 zone)

EMBL: CP001053.PE226

CP001053.PE226       Location/Qualifiers
FT   CDS             complement(264867..265595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4220"
FT                   /product="haloacid dehalogenase, type II"
FT                   /note="TIGRFAM: haloacid dehalogenase, type II;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 2
FT                   (HAD-like); PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: bam:Bamb_3446 haloacid dehalogenase, type
FT                   II"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4220"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18601"
FT                   /db_xref="GOA:B2TET0"
FT                   /db_xref="InterPro:IPR006328"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B2TET0"
FT                   /protein_id="ACD18601.1"
FT                   /translation="MPNSPEIKALLFDVFGTVVDWRSGVARDVGQFLSRHAVAIDSFAF
FT                   ADAWRRQYAPAMEEIRSGRRQFVRLDVLHKENLLKVLADYGVDNSSISAAELDELNHAW
FT                   HRLDAWPDSVEGLLRLKRHFMIAPLSNGNIRLMIDMAKRAALPWDAILGAEVVRAYKPS
FT                   PQVYVDTVEILGLNPAEVCMVAAHNSDLAAARQCGLKTAFVVRPVEHGPDQQSDLHAEQ
FT                   RWDFAAVDMNDLATQLGCPT"
     MPNSPEIKAL LFDVFGTVVD WRSGVARDVG QFLSRHAVAI DSFAFADAWR RQYAPAMEEI        60
     RSGRRQFVRL DVLHKENLLK VLADYGVDNS SISAAELDEL NHAWHRLDAW PDSVEGLLRL       120
     KRHFMIAPLS NGNIRLMIDM AKRAALPWDA ILGAEVVRAY KPSPQVYVDT VEILGLNPAE       180
     VCMVAAHNSD LAAARQCGLK TAFVVRPVEH GPDQQSDLHA EQRWDFAAVD MNDLATQLGC       240
     PT                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page