(data stored in ACNUC7421 zone)

EMBL: CP001053.PE227

CP001053.PE227       Location/Qualifiers
FT   CDS             265743..266261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4221"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A0242 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4221"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18602"
FT                   /db_xref="GOA:B2TET1"
FT                   /db_xref="UniProtKB/TrEMBL:B2TET1"
FT                   /protein_id="ACD18602.1"
FT                   /translation="MKTLDAMSRAGRAVALVVLSAALSGCYYYVPYGYVPYGVVPTAAA
FT                   PQQYSFSTAATAADGAAVSDATVATNTYIAPAVPAFVAPAYYPVAYPYYGSPAWWGPSV
FT                   SLSFGYWGGCCYGGGRYGYWGRHGYGYWGHGYSGGWGGHGGWGGRGYPGHGMGGGHYWG
FT                   SGGGHGRSH"
     MKTLDAMSRA GRAVALVVLS AALSGCYYYV PYGYVPYGVV PTAAAPQQYS FSTAATAADG        60
     AAVSDATVAT NTYIAPAVPA FVAPAYYPVA YPYYGSPAWW GPSVSLSFGY WGGCCYGGGR       120
     YGYWGRHGYG YWGHGYSGGW GGHGGWGGRG YPGHGMGGGH YWGSGGGHGR SH               172
//

If you have problems or comments...

PBIL Back to PBIL home page