(data stored in ACNUC7421 zone)

EMBL: CP001053.PE228

CP001053.PE228       Location/Qualifiers
FT   CDS             complement(266288..266614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4222"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1018 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4222"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18603"
FT                   /db_xref="GOA:B2TET2"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:B2TET2"
FT                   /protein_id="ACD18603.1"
FT                   /translation="MDEQKRLSMIAYLRRKMTTVGIKVADLKAAIAEDRARQKSARYRS
FT                   AFGDTWDGKGDMPQWLKQATSAGQSLTHFAIDKPSASASRQRPAIDWSRDPFAGTRLAT
FT                   VRAS"
     MDEQKRLSMI AYLRRKMTTV GIKVADLKAA IAEDRARQKS ARYRSAFGDT WDGKGDMPQW        60
     LKQATSAGQS LTHFAIDKPS ASASRQRPAI DWSRDPFAGT RLATVRAS                    108
//

If you have problems or comments...

PBIL Back to PBIL home page