(data stored in ACNUC7421 zone)

EMBL: CP001053.PE230

CP001053.PE230       Location/Qualifiers
FT   CDS             complement(267662..268183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4224"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A1905 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4224"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18605"
FT                   /db_xref="UniProtKB/TrEMBL:B2TET4"
FT                   /protein_id="ACD18605.1"
FT                   /translation="MDDRFDRRELLLHLGDILAALNCLNDANEPGASVAHLVKKHASLE
FT                   HFAFLHALSPTMTTSEFGTRVARSFFSWPSELLEADLNRDTLASTVQQNLFEANPDGWN
FT                   AYLGYVRKKVKWFGTALSNHGKDALAEPSHDVPNETSPIEPPVKVEPTAQADARDEKRG
FT                   WPWPEPRSKS"
     MDDRFDRREL LLHLGDILAA LNCLNDANEP GASVAHLVKK HASLEHFAFL HALSPTMTTS        60
     EFGTRVARSF FSWPSELLEA DLNRDTLAST VQQNLFEANP DGWNAYLGYV RKKVKWFGTA       120
     LSNHGKDALA EPSHDVPNET SPIEPPVKVE PTAQADARDE KRGWPWPEPR SKS              173
//

If you have problems or comments...

PBIL Back to PBIL home page