(data stored in ACNUC7421 zone)

EMBL: CP001053.PE231

CP001053.PE231       Location/Qualifiers
FT   CDS             complement(268356..268850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4225"
FT                   /product="phasin family protein"
FT                   /note="TIGRFAM: phasin family protein; PFAM: Phasin family
FT                   protein; KEGG: bte:BTH_I1867 phasin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4225"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18606"
FT                   /db_xref="InterPro:IPR010127"
FT                   /db_xref="InterPro:IPR018968"
FT                   /db_xref="UniProtKB/TrEMBL:B2TET5"
FT                   /protein_id="ACD18606.1"
FT                   /translation="MSTLIPQQLVAAQQSSLEALFGLTNKAFEGFEQLVALNLQVGKAV
FT                   LAENQEIVTKALSAGNPGALFALQASLSQPVAEKVVAYGRRVHEIVSGVQSEITAAATA
FT                   QGQQFQRDAQGFVESLQKNTPAGSESAVAAWNSVLSAANATYESANKAAKQFVSSVSAV
FT                   H"
     MSTLIPQQLV AAQQSSLEAL FGLTNKAFEG FEQLVALNLQ VGKAVLAENQ EIVTKALSAG        60
     NPGALFALQA SLSQPVAEKV VAYGRRVHEI VSGVQSEITA AATAQGQQFQ RDAQGFVESL       120
     QKNTPAGSES AVAAWNSVLS AANATYESAN KAAKQFVSSV SAVH                        164
//

If you have problems or comments...

PBIL Back to PBIL home page