(data stored in ACNUC7421 zone)

EMBL: CP001053.PE235

CP001053.PE235       Location/Qualifiers
FT   CDS             complement(271815..273062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4229"
FT                   /product="D-amino-acid dehydrogenase"
FT                   /EC_number="1.4.99.6"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   reu:Reut_A2589 D-amino acid dehydrogenase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4229"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18610"
FT                   /db_xref="GOA:B2TET9"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2TET9"
FT                   /protein_id="ACD18610.1"
FT                   /translation="MRILIIGAGVIGLSSAYYLSRAGYDVTVADRHAEVASETSFGNGG
FT                   QLSYSYVAPLAGPGVVSKLPRWLTQRDSPVRFRPKLSVEQWRWCFEFLSACTRARSELT
FT                   TQKLLSLSFLSRTLMHELIAAEPSLDFDFVRSGKLVLHRDANAMQSAVDLLAFQRTLGC
FT                   EQQALSADACVEIEPALAHARSFLAGGIHTPSEDTADCRRFCKGLEAVLRERGVRFLMN
FT                   TPIDGLKFGAKGVEAICDGAPLAADRIVVASGAGAAQLLKPLGIRVAIYPIKGYSLTFD
FT                   LQPHITAPHVSITDFARKVVYARLGERLRVGGIADIGGYSLDADPARFATLRKETATLF
FT                   PEVAQSAASGEWTGLRPATPHGLPIVGPTRYPNLWLNVGHGALGFTLATGSAALLADGL
FT                   AGSNNRELSSAFVLSH"
     MRILIIGAGV IGLSSAYYLS RAGYDVTVAD RHAEVASETS FGNGGQLSYS YVAPLAGPGV        60
     VSKLPRWLTQ RDSPVRFRPK LSVEQWRWCF EFLSACTRAR SELTTQKLLS LSFLSRTLMH       120
     ELIAAEPSLD FDFVRSGKLV LHRDANAMQS AVDLLAFQRT LGCEQQALSA DACVEIEPAL       180
     AHARSFLAGG IHTPSEDTAD CRRFCKGLEA VLRERGVRFL MNTPIDGLKF GAKGVEAICD       240
     GAPLAADRIV VASGAGAAQL LKPLGIRVAI YPIKGYSLTF DLQPHITAPH VSITDFARKV       300
     VYARLGERLR VGGIADIGGY SLDADPARFA TLRKETATLF PEVAQSAASG EWTGLRPATP       360
     HGLPIVGPTR YPNLWLNVGH GALGFTLATG SAALLADGLA GSNNRELSSA FVLSH            415
//

If you have problems or comments...

PBIL Back to PBIL home page