(data stored in ACNUC7421 zone)

EMBL: CP001053.PE236

CP001053.PE236       Location/Qualifiers
FT   CDS             complement(273265..274356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4230"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; ThiJ/PfpI domain protein; KEGG: pol:Bpro_1392
FT                   transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4230"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18611"
FT                   /db_xref="GOA:B2TEU0"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEU0"
FT                   /protein_id="ACD18611.1"
FT                   /translation="MPTARSSSPASPATAPTAHELVEQLDALPRALQARPSRSEAELSV
FT                   GILLWPRFPMLSLAGLCDALRHAADRGDQSRQLRCLWTIVGVQAEAVEASCGIPVRVQS
FT                   AFPDVTQFDYVVVIGGLLPHLDQVDRRYWDYLQQAAQAGIPLVGMCTGSFVLARAGLLE
FT                   DRVACVHSFHLDDYRRMFPSLRVITHADYLIDGNRITCAGGISVVELAARLISLHCGPD
FT                   RASKVIHQMTVSRQGGSSFVERRAALGYLSVDDATVRHAVLLMEENLEAPLNIAVIAKM
FT                   IGTSVRNLERAFMSEMNASPNEFYRRMRLRYARWMLVNTARKITDIAYECGFADSAHFI
FT                   RAFREAYGVTPGKLRASRSVATS"
     MPTARSSSPA SPATAPTAHE LVEQLDALPR ALQARPSRSE AELSVGILLW PRFPMLSLAG        60
     LCDALRHAAD RGDQSRQLRC LWTIVGVQAE AVEASCGIPV RVQSAFPDVT QFDYVVVIGG       120
     LLPHLDQVDR RYWDYLQQAA QAGIPLVGMC TGSFVLARAG LLEDRVACVH SFHLDDYRRM       180
     FPSLRVITHA DYLIDGNRIT CAGGISVVEL AARLISLHCG PDRASKVIHQ MTVSRQGGSS       240
     FVERRAALGY LSVDDATVRH AVLLMEENLE APLNIAVIAK MIGTSVRNLE RAFMSEMNAS       300
     PNEFYRRMRL RYARWMLVNT ARKITDIAYE CGFADSAHFI RAFREAYGVT PGKLRASRSV       360
     ATS                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page