(data stored in ACNUC7421 zone)

EMBL: CP001053.PE243

CP001053.PE243       Location/Qualifiers
FT   CDS             283325..283900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4238"
FT                   /product="S-(hydroxymethyl)glutathione synthase"
FT                   /EC_number="4.4.1.22"
FT                   /note="KEGG: bam:Bamb_5797 glutathione-dependent
FT                   formaldehyde-activating enzyme; TIGRFAM:
FT                   S-(hydroxymethyl)glutathione synthase; PFAM:
FT                   glutathione-dependent formaldehyde-activating GFA"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4238"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18618"
FT                   /db_xref="GOA:B2TEU3"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR014185"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEU3"
FT                   /protein_id="ACD18618.1"
FT                   /translation="MTRAIHLSVDHGIQKGASDFGGGTLRCSCTNDPVEVHVDTQVLYN
FT                   HACGCTQCWKPEHTLSSVVGVVPREKVAVTSHREKLKVRDDTALIQRDARTACGTHLYG
FT                   RIENKERAFYGLDFIQTELSTEAGWDGPGFAPFVSSIIESGTAPSSMVEVRQTPREKGL
FT                   EPYDCLSPALMDILAAHSAKAKSTHSEA"
     MTRAIHLSVD HGIQKGASDF GGGTLRCSCT NDPVEVHVDT QVLYNHACGC TQCWKPEHTL        60
     SSVVGVVPRE KVAVTSHREK LKVRDDTALI QRDARTACGT HLYGRIENKE RAFYGLDFIQ       120
     TELSTEAGWD GPGFAPFVSS IIESGTAPSS MVEVRQTPRE KGLEPYDCLS PALMDILAAH       180
     SAKAKSTHSE A                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page