(data stored in ACNUC7421 zone)

EMBL: CP001053.PE246

CP001053.PE246       Location/Qualifiers
FT   CDS             287713..288102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4242"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: psa:PST_3582 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4242"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18621"
FT                   /db_xref="GOA:B2TEV0"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="PDB:2RBB"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEV0"
FT                   /protein_id="ACD18621.1"
FT                   /translation="MADLSYVNIFTRDIVALSAFYQQVFGFQEIESIRSPIFRGLDTGK
FT                   SCIGFNAHEAYELLQLAQFSETSGIKFLLNFDVDTKEAVDKLVPVAIAAGATLIKAPYE
FT                   TYYHWYQAVLLDPERNVFRINNVLL"
     MADLSYVNIF TRDIVALSAF YQQVFGFQEI ESIRSPIFRG LDTGKSCIGF NAHEAYELLQ        60
     LAQFSETSGI KFLLNFDVDT KEAVDKLVPV AIAAGATLIK APYETYYHWY QAVLLDPERN       120
     VFRINNVLL                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page