(data stored in ACNUC7421 zone)

EMBL: CP001053.PE247

CP001053.PE247       Location/Qualifiers
FT   CDS             288118..289092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4243"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; oxidoreductase FAD/NAD(P)-binding
FT                   domain protein; Oxidoreductase FAD-binding domain protein;
FT                   KEGG: mms:mma_2506 oxidoreductase/oxygenase, VanB family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4243"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18622"
FT                   /db_xref="GOA:B2TEV1"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEV1"
FT                   /protein_id="ACD18622.1"
FT                   /translation="MKSSETFEVEVRGIRIEAETVRSFELWPVSGELPPFTAGAHIDVH
FT                   LSHGMTRQYSLTNSLERHRYVIAVQRDPGGAGGSMSMHDSVALGSRLIVSAPRNYFPLN
FT                   EAAVHSVLIAGGIGVTPLLAMVRRLCQLGLSWDFYYCARVPARAAFLSELKELAATTYP
FT                   DRALHCVFDGEAGVTSLNLGDVRAAHRPDSDFYCCGPAPLMDAFSTTFASLPPERVHLE
FT                   YFKAPVADTLGEAEGAFTVTLSRQGKTLVVPPNRSILEVLRENGVPMLSSCRQGICGTC
FT                   ETRVVEGVPDHRDHVLTPAERASNQTMMICVSRCKGEALTLDI"
     MKSSETFEVE VRGIRIEAET VRSFELWPVS GELPPFTAGA HIDVHLSHGM TRQYSLTNSL        60
     ERHRYVIAVQ RDPGGAGGSM SMHDSVALGS RLIVSAPRNY FPLNEAAVHS VLIAGGIGVT       120
     PLLAMVRRLC QLGLSWDFYY CARVPARAAF LSELKELAAT TYPDRALHCV FDGEAGVTSL       180
     NLGDVRAAHR PDSDFYCCGP APLMDAFSTT FASLPPERVH LEYFKAPVAD TLGEAEGAFT       240
     VTLSRQGKTL VVPPNRSILE VLRENGVPML SSCRQGICGT CETRVVEGVP DHRDHVLTPA       300
     ERASNQTMMI CVSRCKGEAL TLDI                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page